AWSDataLifecycleManagerServiceRole

OperatorService roleActivePermissions reviewedShow on map Compare

Summary

Provides appropriate permissions to AWS Data Lifecycle Manager to take actions on AWS resources

Permissions imported from the AWS Managed Policy Reference Guide; other sections pending editorial review.

Identity

ARN: arn:aws:iam::aws:policy/service-role/AWSDataLifecycleManagerServiceRole
Default version: v10
Created: 2018-07-06
Last edited: 2026-02-12
Services: ec2, events

Control-plane actions (24)

By access level: 8 List, 1 Permissions management, 1 Read, 1 Tagging, 13 Write.

Control-plane actions by service
Service	Granted	Access levels and limits	Granted by
EC2	16 of 834	7 List, 1 Permissions management, 1 Tagging, 7 Write; 1 restricted, 0 conditional	ec2:CopySnapshot, ec2:CreateSnapshot, ec2:CreateSnapshots, ec2:CreateTags, ec2:DeleteSnapshot, ec2:DescribeAvailabilityZones, ec2:DescribeFastSnapshotRestores, ec2:DescribeInstances, ec2:DescribeSnapshotAttribute, ec2:DescribeSnapshotTierStatus, ec2:DescribeSnapshots, ec2:DescribeVolumes and 4 more
EventBridge	8 of 71	1 List, 1 Read, 6 Write; 8 restricted, 0 conditional	events:DeleteRule, events:DescribeRule, events:DisableRule, events:EnableRule, events:ListTargetsByRule, events:PutRule, events:PutTargets, events:RemoveTargets

EC2: 16 actions

ec2:CopySnapshot (Write)
ec2:CreateSnapshot (Write)
ec2:CreateSnapshots (Write)
ec2:CreateTags (Tagging)
ec2:DeleteSnapshot (Write)
ec2:DescribeAvailabilityZones (List)
ec2:DescribeFastSnapshotRestores (List)
ec2:DescribeInstances (List)
ec2:DescribeSnapshotAttribute (List)
ec2:DescribeSnapshotTierStatus (List)
ec2:DescribeSnapshots (List)
ec2:DescribeVolumes (List)
ec2:DisableFastSnapshotRestores (Write)
ec2:EnableFastSnapshotRestores (Write)
ec2:ModifySnapshotAttribute (Permissions management)
ec2:ModifySnapshotTier (Write)

EventBridge: 8 actions

events:DeleteRule (Write)
events:DescribeRule (Read)
events:DisableRule (Write)
events:EnableRule (Write)
events:ListTargetsByRule (List)
events:PutRule (Write)
events:PutTargets (Write)
events:RemoveTargets (Write)

Data-plane actions (0)

By access level: none.

This policy grants no actions in this plane.

Excluded and conditional actions

No patterns are excluded by NotAction or Deny statements.

Resource scope and attachment

Resource scope across granted actions: mixed.

Can be attached: Yes, to users, groups and roles.

Why this tier

Grants 15 write, tagging or permissions-management actions, short of full control of any service.

Guidance

Pending editorial review. The permission data on this page comes straight from AWS; this section will be filled in once a reviewed guide exists.

Same service

Same domain

Frequently asked questions

Pending editorial review. The permission data on this page comes straight from AWS; this section will be filled in once a reviewed guide exists.

Policy JSON

Download policy.json

{
  "Version": "2012-10-17",
  "Statement": [
    {
      "Effect": "Allow",
      "Action": [
        "ec2:CreateSnapshot",
        "ec2:CreateSnapshots",
        "ec2:DeleteSnapshot",
        "ec2:DescribeInstances",
        "ec2:DescribeVolumes",
        "ec2:DescribeSnapshots",
        "ec2:EnableFastSnapshotRestores",
        "ec2:DescribeFastSnapshotRestores",
        "ec2:DisableFastSnapshotRestores",
        "ec2:CopySnapshot",
        "ec2:ModifySnapshotAttribute",
        "ec2:DescribeSnapshotAttribute",
        "ec2:DescribeSnapshotTierStatus",
        "ec2:ModifySnapshotTier",
        "ec2:DescribeAvailabilityZones"
      ],
      "Resource": "*"
    },
    {
      "Effect": "Allow",
      "Action": [
        "ec2:CreateTags"
      ],
      "Resource": "arn:aws:ec2:*::snapshot/*"
    },
    {
      "Effect": "Allow",
      "Action": [
        "events:PutRule",
        "events:DeleteRule",
        "events:DescribeRule",
        "events:EnableRule",
        "events:DisableRule",
        "events:ListTargetsByRule",
        "events:PutTargets",
        "events:RemoveTargets"
      ],
      "Resource": "arn:aws:events:*:*:rule/AwsDataLifecycleRule.managed-cwe.*"
    }
  ]
}

Version history

Current version v10, edited by AWS on 2026-02-12. Version history is recorded from 2026-11-11. Earlier versions are in the IAM console under Policy versions.

Attach snippets

AWS CLI

aws iam attach-role-policy --role-name ROLE_NAME --policy-arn arn:aws:iam::aws:policy/service-role/AWSDataLifecycleManagerServiceRole
aws iam attach-user-policy --user-name USER_NAME --policy-arn arn:aws:iam::aws:policy/service-role/AWSDataLifecycleManagerServiceRole
aws iam attach-group-policy --group-name GROUP_NAME --policy-arn arn:aws:iam::aws:policy/service-role/AWSDataLifecycleManagerServiceRole

CloudFormation

Resources:
  ExampleRole:
    Type: AWS::IAM::Role
    Properties:
      AssumeRolePolicyDocument: {}  # replace with your trust policy
      ManagedPolicyArns:
        - arn:aws:iam::aws:policy/service-role/AWSDataLifecycleManagerServiceRole

Terraform

resource "aws_iam_role_policy_attachment" "service_role_awsdatalifecyclemanagerservicerole" {
  role       = aws_iam_role.example.name
  policy_arn = "arn:aws:iam::aws:policy/service-role/AWSDataLifecycleManagerServiceRole"
}

CDK (TypeScript)

role.addManagedPolicy(
  iam.ManagedPolicy.fromAwsManagedPolicyName("service-role/AWSDataLifecycleManagerServiceRole"),
);

Sources

Pending editorial review. No editorial sources are listed yet.